PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G153900.1
Common NameB456_001G153900, LOC105795828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 694aa    MW: 76967.7 Da    PI: 7.0423
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G153900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.98.3e-23130230198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+k+lt sd++++g +++ +k+a+e+     +++ + +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   +
  Gorai.001G153900.1 130 FCKILTASDTSTHGGFSVLRKHATEClppldMNQATPTQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--R 218
                         99****************************9555556679************************************************..3 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+++r
  Gorai.001G153900.1 219 GDNGELRVGARR 230
                         489999**9987 PP

2Auxin_resp101.98.4e-34256335183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aaha++t++ F v+Y+Pr+  s+F++ v+k+++a+k+ +svGmRfkm+fe+ed + rr++Gt+vgv d++p +W++SkWr Lk
  Gorai.001G153900.1 256 AAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRRFTGTIVGVGDFSP-HWSESKWRTLK 335
                         79****************6..9*************************************************.********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-39121245IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.76E-40121259IPR015300DNA-binding pseudobarrel domain
CDDcd100175.42E-19129230No hitNo description
PROSITE profilePS5086311.702130232IPR003340B3 DNA binding domain
SMARTSM010192.7E-21130232IPR003340B3 DNA binding domain
PfamPF023625.9E-21130230IPR003340B3 DNA binding domain
PfamPF065075.0E-31256335IPR010525Auxin response factor
PfamPF023091.2E-7560614IPR033389AUX/IAA domain
SuperFamilySSF542771.44E-12574654No hitNo description
PROSITE profilePS5174527.275578670IPR000270PB1 domain
PfamPF023092.5E-6622668IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MANVQVNPRG SSIAHSESGS SDDDLYAELW KLCAGPLVEI PRNHERVFYF PQGHMEQLEA  60
STNQELNNQA PLFNLPSKIL CRVIHVQLLA ELETDDVYAQ ITLQPEADQS EPTSPDPCPA  120
EAPKRTVNSF CKILTASDTS THGGFSVLRK HATECLPPLD MNQATPTQEL AAKDLHGYEW  180
RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDAFVFLRGD NGELRVGARR LARQQTTMPS  240
SVISSQSMHL GVLATAAHAV TTQTLFVVYY KPRTSQFIIG VNKYLEAIKN GFSVGMRFKM  300
RFEGEDTPDR RFTGTIVGVG DFSPHWSESK WRTLKIQWDE PATIQRPERV SPWEIEPFAP  360
SASINLVQPA VKNKRPRPVD IPVSEITTNS AGSTFWGRGS TQSHELTQVG STPEIQSSES  420
QVMWGMRQKE ADYSRGYNSN AWPHSPLVNV SLNLFPNSVS DKNRTEKPQT TLTGYALPSL  480
SRPSKGLMHD QVEKGKKSET STGCRLFGFN LTDTISAVIP TDKEQTNTTV DHNGVWGSLA  540
AASHIDQNPE TAKQKHVAAE ASSKEMQAKQ GASTTSTRSR TKVQMQGIAV GRAVDLTVLK  600
GYDDLINEVE KMFDIKGELR PSGKWSVVFT DDEGDMMLVG DDPWMDFCKM VRKIFIYSSE  660
EVKKISPRCK FAVSSLEGEG TAVTIDSEHK SET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1731935813355Auxin response factor 1
4ldw_A1e-1731935813355Auxin response factor 1
4ldv_A1e-1731935813355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1373377KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012480938.10.0PREDICTED: auxin response factor 18 isoform X1
RefseqXP_012480942.10.0PREDICTED: auxin response factor 18 isoform X1
RefseqXP_012480944.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0D2QR000.0A0A0D2QR00_G
STRINGPOPTR_0014s09560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]